Tube of Beta-Amyloid (42-1) peptide
Peptides

Beta-Amyloid (42-1)

€142.00
Check your price
  • Cat.Number : AS-27276-01
  • Availability :
    In stock

Size

Quantity

Add to wishlist

This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-42.

Specifications

Chemistry
Sequence one letter code
  • AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Sequence three letter code
  • H-Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH
CAS registry number
  • 317366-82-8
Molecular Formula
  • C203H311N55O60S
Molecular Mass/ Weight
  • 4514.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

Downloads

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
€348.00 Excl. Tax
Image of a kit SensoLyte 520 Neprilysin Activity Assay Kit Fluorimetric

SensoLyte® 520 Neprilysin Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72223
€619.00 Excl. Tax
Image of a kit SensoLyte Thioflavin T Beta-Amyloid (1-42) Aggregation Kit

SensoLyte® Thioflavin T ß-Amyloid (1-42) Aggregation Kit - 1 kit

Cat.Number : AS-72214
€603.00 Excl. Tax

Citations

Regulation of Matrix Metalloproteinase 2 by Oligomeric Amyloid β Protein

Brain Res . 2011 Mar 02 ; 1387 141 | DOI : 10.1016/j.brainres.2011.02.078

  • W. Li
  • et al

Structural and functional alterations in amyloid-β precursor protein induced by amyloid-β peptides

J Alzheimers Dis . 2014 Apr 28 ; 25(3) 547 | DOI : 10.3233/JAD-2011-101938

  • CP. Libeu
  • et al

Chronic psychosocial stress accelerates impairment of long-term memory and late-phase long-term potentiation in an at-risk model of Alzheimer's disease

Hippocampus . 2011 Jun 24 ; 21(7) | DOI : https://doi.org/10.1002/hipo.20790

  • TT. Tran
  • et al

Amyloid β Interaction with Receptor for Advanced Glycation End Products Up-Regulates Brain Endothelial CCR5 Expression and Promotes T Cells Crossing the Blood-Brain Barrier

J Immunol . 2009 May 01 ; 182(9) 5778 | DOI : https://doi.org/10.4049/jimmunol.0803013

  • M. Li
  • et al

The NALP3 inflammasome is involved in the innate immune response to amyloid-β

Nat Immunol. . 2008 Jul 11 ; 9(8) 857 | DOI : 10.1038/ni.1636

  • A. Halle
  • et al

Lipid-Induced β-Amyloid Peptide Assemblage Fragmentation

Biophys J . 2006 Dec 01 ; 91(11) 4071 | DOI : 10.1529/biophysj.106.085944

  • MJO. Widenbrant
  • et al

Measurement of anti-Aβ1–42 antibodies in intravenous immunoglobulin with indirect ELISA: The problem of nonspecific binding.

J Neurosci Methods . 2010 Jan 25 ; 187(2) 263 | DOI : 10.1016/j.jneumeth.2010.01.018

  • A. Klaver
  • et al

Aβ 1-42 induces mild endoplasmic reticulum stress in an aggregation state-dependent manner.

Antioxid Redox Signaling . 2007 Dec 01 ; 9(12) 2245 | DOI : 10.1089/ars.2007.1797

  • SM. Chafekar
  • et al

Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina.

Exp Brain Res . 2007 Apr 12 ; 181(3) 435 | DOI : 10.1007/s00221-007-0943-y

  • K. Xiong
  • et al

Proteomic identification of proteins oxidized by Aβ(1–42) in synaptosomes: Implications for Alzheimer's disease.

Brain Res . 2005 Apr 15 ; 1044(2) 206 | DOI : 10.1016/j.brainres.2005.02.086

  • D. Boyd-Kimball
  • et al