We use cookies to offer you the best experience on our site. You can find out more about the cookies we use or disable them in the Cookie settings
Products
181 - 200 of 2147
PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat - 0.5 mg
- HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
- Cat.Number : AS-23648
Orexin A, bovine, human, mouse, rat - 1 mg
- Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
- Cat.Number : AS-24470
EDANS, acid [5-((2-Aminoethyl)amino)naphthalene-1-sulfonic acid] - 1 g
- Cat.Number : AS-23887
Beta-Amyloid (2-40) - 1 mg
- AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-29905-1
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5-TMR labeled - 1 mg
- 5-TMR-KVEKIGEGTYGVVYK
- Cat.Number : AS-29935-1
MBP, MAPK Substrate, Biotinylated, Phosphorylated [Biotin-APR-pT-PGGRR] - 1 mg
- Biotin-APR-pT-PGGRR
- Cat.Number : AS-29877
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], 5-FAM labeled - 5 mg
- 5-FAM-DADE-pY-LIPQQG
- Cat.Number : AS-29971-5
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ] - 1 mg
- ADEYLIPQQ
- Cat.Number : AS-29942-1
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], Biotinylated - 1 mg
- Biotin-DADE-pY-LIPQQG
- Cat.Number : AS-29972-1
[Pyr11]-beta-Amyloid (11-40) - 1 mg
- Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-29904-1
SensoLyte® Anti-Mouse MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55156
SensoLyte® Anti-MOG(35-55) IgG Quantitative ELISA Kit (mouse/rat) Colorimetric - 1 kit
- Cat.Number : AS-54465
SensoLyte® Anti-Human MOG (1-125) Mouse IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-M
Beta-Amyloid (4-42) - 1 mg
- FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- Cat.Number : AS-29908-1
SensoLyte® Anti-Human MOG (1-125) Human IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-H
Human recombinant a-Synuclein (1-140), HiLyte™ Fluor 488 labeled - 200 µg
- Cat.Number : AS-55457
181 - 200 of 2147