Peptides

Scrambled-beta-Amyloid (1-42)

364.00
Check your price
  • Cat.Number : AS-25382
  • Availability :
    In stock

Size

Alternative choices

Quantity

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-42.

Specifications

Chemistry
Sequence one letter code
  • AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence three letter code
  • H-Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala-OH
CAS registry number
  • 1678415-52-5
Molecular Formula
  • C203H311N55O60S
Molecular Mass/ Weight
  • 4514.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26
Alphabet Assignement

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
376.00 Excl. Tax
Image of a kit SensoLyte 520 Neprilysin Activity Assay Kit Fluorimetric

SensoLyte® 520 Neprilysin Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72223
669.00 Excl. Tax
Image of a kit SensoLyte Thioflavin T Beta-Amyloid (1-42) Aggregation Kit

SensoLyte® Thioflavin T ß-Amyloid (1-42) Aggregation Kit - 1 kit

Cat.Number : AS-72214
685.00 Excl. Tax

Citations

Hypersensitivity of the hippocampal CA3 region to stress-induced neurodegeneration and amyloidogenesis in a rat model of surgical menopause

Brain . 2013 May 01 ; 136(Pt 5) 1432 | DOI : 10.1093/brain/awt046

  • QG. Zhang
  • et al

Amyloid beta dimers/trimers potently induce cofilin-actin rods that are inhibited by maintaining cofilin-phosphorylation

Mol Neurodegener . 2011 Jan 24 ; 6 10 | DOI : 10.1186/1750-1326-6-10

  • RC. Davis
  • et al

Gelsolin Restores A-Induced Alterations in Choroid Plexus Epithelium

J Biomed and Biotech . 2010 Jan 19 ; 2010 7 | DOI : http://dx.doi.org/10.1155/2010/805405

  • T. Vargas
  • et al

Mutant presenilin 1 increases the expression and activity of BACE1

JBC . 2009 Feb 05 ; 284 9027 | DOI : 10.1074/jbc.M805685200

  • L. Giliberto
  • et al

Spatial Memory Impairment Without Apoptosis Induced by the Combination of Beta-Amyloid Oligomers and Cerebral Ischemia Is Related to Decreased Acetylcholine Release in Rats

J Pharmacol Sci . 2007 Nov 13 ; 106 84 | DOI : 10.1254/jphs.fp0071648

  • T. Watanabe
  • et al

Gelsolin Restores Aβ-Induced Alterations in Choroid Plexus Epithelium

J Biomed Biotechnol . 2010 Mar 25 ; 2010 805405 | DOI : https://doi.org/10.1155/2010/805405

  • T. Vargas
  • et al

Aβ induces cell death by direct interaction with its cognate extracellular domain on APP (APP 597–624).

FASEB Journal. . 2006 Apr 24 ; 20(8) 1254 | DOI : https://doi.org/10.1096/fj.05-5032fje

  • GM. Shaked
  • et al

Spreading of neurodegenerative pathology via neuron-to-neuron transmission of β-amyloid

J Neurosci. . 2012 Jun 27 ; 32(26) 8767 | DOI : 10.1523/JNEUROSCI.0615-12.2012

  • S. Nath
  • et al

Interaction between 24-hydroxycholesterol, oxidative stress and amyloid-β in amplifying neuronal damage in Alzheimer’s disease: three partners in crime

Aging Cell. . 2011 Apr 05 ; 10(3) 403 | DOI : 10.1111/j.1474-9726.2011.00681.x

  • P. Gamba
  • et al

Neprilysin protects against cerebral amyloid angiopathy and Aβ-induced degeneration of cerebrovascular smooth muscle cells

Brain Pathol. . 2011 Apr 03 ; 21(5) 594 | DOI : 10.1111/j.1750-3639.2011.00486.x

  • J. Miners
  • et al

Gelsolin restures Aβ-induced alterations in choroid plexus epithelium

J Biomed Biotechnol. . 2010 Mar 25 ; 2010 805405 | DOI : 10.1155/2010/805405

  • T. Vargas
  • et al

Protection of synapes against Alzheimer's-linked toxins: insulin signaling prevents the pathogenic binding of Aβ oligomers

Proc Natl Acad Sci U S A. . 2009 Feb 02 ; 106(6) 1971 | DOI : 10.1073/pnas.0809158106

  • FG. De Felice
  • et al

Amyloid beta mediates memory formation

Learn Mem. . 2009 Mar 24 ; 16(4) 267 | DOI : 10.1101/lm.1310209

  • A. Garcia-Osta
  • et al

Myelin basic protein binds to and inhibits the fibrillar assembly of Aβ42 in vitro

Biochemistry . 2015 Mar 20 ; 48(22) 4720 | DOI : 10.1021/bi900037s

  • M. Hoos
  • et al

Abeta induces cell death by direct interaction with its cognate extracellular domain on APP (APP 597-624).

FASEB J. . 2006 Apr 24 ; 20(8) 1254 | DOI : 10.1096/fj.05-5032fje

  • GM. Shaked
  • et al

β -Secretase-Cleaved Amyloid Precursor Protein Accumulates at Actin Inclusions Induced in Neurons by Stress or Amyloid β : A Feedforward Mechanism for Alzheimer’s Disease

J Neurosci. . 2005 Dec 07 ; 25(49) 11313 | DOI : https://doi.org/10.1523/JNEUROSCI.3711-05.2005

  • MT. Maloney
  • et al

Amyloid-β Peptide Inhibits Activation of the Nitric Oxide/cGMP/cAMP-Responsive Element-Binding Protein Pathway during Hippocampal Synaptic Plasticity

J Neurosci. . 2005 Jul 20 ; 25(29) 6887 | DOI : 10.1523/JNEUROSCI.5291-04.2005

  • D. Puzzo
  • et al

In Vitro Studies of Flemish, Dutch, and Wild-Type β-Amyloid Provide Evidence for Two-Staged Neurotoxicity

Neurobiol Dis. . 2002 Nov 01 ; 11(2) 330 | DOI : 10.1006/nbdi.2002.0529

  • S. Kumar-Singh
  • et al

Modeling Alzheimer's disease immune therapy mechanisms: Interactions of human postmortem microglia with antibody-opsonized amyloid beta peptide

J Neurosci Res. . 2002 Nov 15 ; 70(4) 599 | DOI : 10.1002/jnr.10422

  • LF. Lue
  • DG. Walker