Peptides

CRAMP, mouse - 1 mg

334.00
Check your price
  • Cat.Number : AS-61305
  • Availability :
    In stock

Alternative choices

Quantity

This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.

Specifications

Chemistry
Sequence one letter code
  • GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Sequence three letter code
  • H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
CAS registry number
  • 376364-36-2
Molecular Formula
  • C178H302N50O46
Molecular Mass/ Weight
  • 3878.7
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • mouse
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of CRAMP peptide, rat

CRAMP, rat - 0.5 mg

Cat.Number : AS-61306
281.00 Excl. Tax
Tube of hBD-1 peptide, ?-Defensin-1 peptide, human

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
374.00 Excl. Tax

Citations

Cationic antimicrobial peptides serve as activation signals for the Salmonella Typhimurium PhoPQ and PmrAB regulons in vitro and in vivo.

Front Cell Infect Microbiol. . 2012 Jul 27 ; 2 102 | DOI : 10.3389/fcimb.2012.00102

  • SM. Richards
  • et al

Fluorescence and UV Resonance Raman Study of Peptide−Vesicle Interactions of Human Cathelicidin LL-37 and Its F6W and F17W Mutants

Biochemistry. . 2009 Dec 01 ; 48(47) 11264 | DOI : 10.1021/bi900996q

  • JE. Gable
  • et al

Toxins and antimicrobial peptides: interactions with membranes

Proc SPIE Int Soc Opt Eng.  . 2009 Aug 21 ; 7397 pii73970J | DOI : 10.1117/12.827439

  • DE. Schlamadinger
  • et al

Nafcillin enhances innate immune-mediated killing of methicillin-resistant Staphylococcus aureus.

J Mol Med . 2013 Dec 03 ; 92(2) 139 | DOI : 10.1007/s00109-013-1100-7

  • G. Sakoulas
  • et al

β-Defensins activate human mast cells via Mas-Related Gene X2.

J Immunol . 2013 May 22 ; 191(1) 345 | DOI : 10.4049/​jimmunol.1300023.

  • H. Subramanian
  • et al

Mammalian antimicrobial peptide influences control of cutaneous Leishmania infection.

Cell Microbiol . 2011 Apr 28 ; 13(6) 913 | DOI : 10.1111/j.1462-5822.2011.01589.x.

  • MM. Kulkarni
  • et al

Plasmacytoid dendritic cells sense skin injury and promote wound healing through type I interferons

J Exp Med . 2010 Nov 29 ; 207(13) 2921 | DOI : 10.1084/jem.20101102

  • J. Gregorio
  • et al

Fluorescence and UV resonance Raman study of peptide−vVesicle interactions of human cCathelicidin LL-37 and its F6W and F17W mutants

Biochem . 2009 Dec 01 ; 48(47) 11264 | DOI : 10.1021/bi900996q.

  • JE. Gable
  • et al

Induction of group A Streptococcus virulence by a human antimicrobial peptide.

PNAS . 2008 Oct 28 ; 105(43) 16755 | DOI : 10.1073/pnas.0803815105

  • I. Gryllos
  • et al