Peptides

hBD-1, b-Defensin-1, human - 0.1 mg

417.00
Check your price
  • Cat.Number : AS-60740
  • Availability :
    In stock

Alternative choices

Quantity

Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds.
This peptide (3.9kDa, 36-amino acids) has a beta sheet with three intramolecular disulfide bonds. It is constitutively produced by various epithelial tissues including urogenital and respiratory tracts. Its expression is also inducible in keratinocytes of whole human skin by lipopolysaccharides and peptidoglycan. hBD-1 exhibits antimicrobial activity against several pathogenic microorganisms including E.coli, although its activity is dependent on salt sensitivity, because it is inhibited by salt in a concentration-dependent manner. In addition to its antimicrobial activity, hBD-1 chemoattracts CC chemokine receptor (CCR)6-expressing HEK293 cells, implying that this peptide utilizes CCR6 as a receptor.

Specifications

Chemistry
Sequence one letter code
  • DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
Sequence three letter code
  • H-Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys-OH (Disulfide bridge: 5-34, 12-27, 17-35)
Molecular Formula
  • C167H256N48O50S6
Molecular Mass/ Weight
  • 3928.7
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of hBD-3 peptide, ?-Defensin-3 peptide, human

hBD-3, b-Defensin-3, human - 0.1 mg

Cat.Number : AS-60741
417.00 Excl. Tax
Tube of HNP-1 peptide, a-Defensin-1

HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg

Cat.Number : AS-60743
272.00 Excl. Tax
Tube of HNP-2 peptide, a-Defensin-2

HNP-2, a-Defensin-2, Human Neutrophil Peptide-2 - 0.1 mg

Cat.Number : AS-60744
296.00 Excl. Tax

Citations

Burkholderia cenocepacia zinc metalloproteases influence resistance to antimicrobial peptides.

Microbiology. . 2009 Jun 18 ; 155(Pt9) 2818 | DOI : 10.1099/mic.0.028969-0

  • C. Kooi
  • PA. Sokol