Peptides

hBD-3, b-Defensin-3, human - 0.1 mg

$367.00
Check your price
  • Cat.Number : AS-60741
  • Availability :
    In stock

Alternative choices

Quantity

Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds.
This is a 5.1kDa 45-amino acid antimicrobial peptide called beta-Defensin-3 (hBD-3) having a beta sheet with three intramolecular disulfide bonds. It is expressed in high levels in keratinocytes and tonsilar tissue while expressed low in epithelia of the respiratory, gastrointestinal and genito-urinary tracts. Factors that induce its expression include TNF-alpha, IL-1beta and bacteria such as P. aeruginosa and S. aureus. hBD-3 is also potentially induced after exposure to IFN-gamma. In contrast to hBD-1, -2 and -4, hBD-3 demonstrates a salt-insensitive antimicrobial activity towards several pathogenic microorganisms at physiologic salt concentrations. This makes hBD-3 uniquely and particularly relevant in diseases where other hBDs show inactivity. The ability of hBD-3 to elicit its antimicrobial activity more effectively at the concentrations lower that those of hBD-1 and hBD-2 has been attributed to its amphipathic dimer structure and the increased positive surface charge (+9), compared to hBD-1 (+4) and hBD-2 (+6). hBD-3 has been shown to induce cytokine production from human keratinocytes and stimulates monocyte migration.

Specifications

Chemistry
Sequence one letter code
  • GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
Sequence three letter code
  • H-Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys -OH (Disulfide bridge: 11-40, 18-33, 23-41)
Molecular Formula
  • C216H371N75O59S6
Molecular Mass/ Weight
  • 5155.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of hBD-1 peptide, ?-Defensin-1 peptide, human

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
$367.00 Excl. Tax
Tube of HNP-1 peptide, a-Defensin-1

HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg

Cat.Number : AS-60743
$240.00 Excl. Tax
Tube of HNP-2 peptide, a-Defensin-2

HNP-2, a-Defensin-2, Human Neutrophil Peptide-2 - 0.1 mg

Cat.Number : AS-60744
$261.00 Excl. Tax

Citations

Masking of β(1-3)-Glucan in the Cell Wall of Candida albicans from Detection by Innate Immune Cells Depends on Phosphatidylserine.

Infect Immun . 2014 Aug 11 ; 82(10) 4405 | DOI : 10.1128/IAI.01612-14.

  • SE. Davis
  • et al